SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011423 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011423
Domain Number 1 Region: 109-291
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-50
Family Inorganic pyrophosphatase 0.000011
Further Details:      
 
Domain Number 2 Region: 3-17,47-73
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 0.000000222
Family Inorganic pyrophosphatase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011423   Gene: ENSTBEG00000013177   Transcript: ENSTBET00000013186
Sequence length 294
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4229:131972:233489:-1 gene:ENSTBEG00000013177 transcript:ENSTBET00000013186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVAGHYISPFHDIPLKVDSEESTEAADFIDLSKIWENHIPTKKARSDDYENLFNMVVEVP
RWTNAKMEIAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTWEDPHQKDKST
NCCGDNDPVDVCEIGSKSSRGXXXRVKILGILALIDQGETDWKLIAINVNDPEASNFHDI
GDVKKFKPGYLEATLNWFRFYKVPDGKPENQFAFNGEFKNKXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXTNVQVCGSPFHCTPEEARSVVESVSSSQSKESSEEEQTWHFLGN
Download sequence
Identical sequences ENSTBEP00000011423 ENSTBEP00000011423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]