SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011604 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000011604
Domain Number - Region: 25-68
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.00644
Family Ribosomal protein L11, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011604   Gene: ENSTBEG00000013401   Transcript: ENSTBET00000013397
Sequence length 79
Comment pep:novel scaffold:TREESHREW:scaffold_95674:3721:4049:-1 gene:ENSTBEG00000013401 transcript:ENSTBET00000013397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILHVDLCVSGKDGVSVPLRAQIEVLPSTSALIIKVLEESPRDRKEQKNTKHSGNIIFNKI
VYTSQTCHQSLPQELPRII
Download sequence
Identical sequences ENSTBEP00000011604 ENSTBEP00000011604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]