SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011726 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011726
Domain Number 1 Region: 383-544,587-750
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.65e-46
Family WD40-repeat 0.011
Further Details:      
 
Domain Number 2 Region: 715-866
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000000192
Family Quinoprotein alcohol dehydrogenase-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011726   Gene: ENSTBEG00000013511   Transcript: ENSTBET00000013538
Sequence length 980
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2938:85710:275359:1 gene:ENSTBEG00000013511 transcript:ENSTBET00000013538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGFAGSLDDSISAASTSDVQDRLSALELRVQQQEDEITVLKAALADVSRRLAISEDHVA
SVKKSVPTKGQVGLREAISMSCITNGSVANRKPSHTSSVSIARKETLSSAAKSGTGKKKE
KPQGQREKKEESHSNDQSPQIQASPSPQPSSQPLQIHRQTPESKNSTPTKSIKRPPLTVE
KSHNSWENSDDSRNKLLRTASTSKLISKVIKNTDXXXXXXXXXXGEYIKMFMRGRPITMF
IPSDVDNYDDIRTELPPEKLKLEWVYGYRGDCRANVYLLPTGEIVYFIASVVVLFXXXXX
XXXXXXXXXXXXXXLAIHPDKIRIATGQIAGVDKDGRXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXDSGVHLCVIDDSNEHMLTVWDWQKKSKGAEIKTTNEVVLAVEFHPT
DANTIITSGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVITGDSGGVML
IWSKTTVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDL
NPEREIEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGTFNDGFQIEVQGHTDELWGLAT
HPFKDLLLTCAQDRQVCMWNSAEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRGFVL
DAETRDLVSIHTDGNEQLSVMRYTVDGTLLAVGSHDNFIYLYAVSENGRKYSRYGKCTGH
SSYITHLDWSPDNTYIMSNSGDYEILYWNIPEGCKLIRNRSECKDIDWTTYTCVLGFQVF
GVWPEGSDGTDINALVRSHNRRVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNV
SFTYNDSHLISTGGKDMSIIQWKLVEKLPLPQNETVADTTLTKAPTSTIENAIQSNTPTP
PPSQPLHETAEEERLSSSPTLLENSLEQTVEPSEDHSEEQSEGGSEDLGEPVDEDPPSET
REEQSEAALPEDRQDASPLS
Download sequence
Identical sequences ENSTBEP00000011726 ENSTBEP00000011726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]