SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011937 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011937
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily SH2 domain 7.14e-27
Family SH2 domain 0.00000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011937   Gene: ENSTBEG00000013788   Transcript: ENSTBET00000013777
Sequence length 132
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5600:443807:467828:-1 gene:ENSTBEG00000013788 transcript:ENSTBET00000013777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPYYHGPLSKRDCETLLLKEGTDGNFLLRDSESLPGVLCLCVSYKNFVYTYRIFKEKQ
GYYKIQTTEGVPKQIFPNLKELISKFEKPDQGLVVQLSKPIKKTNPYLMWRSSKLELEAF
MNSEDDYVNVLP
Download sequence
Identical sequences ENSTBEP00000011937 ENSTBEP00000011937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]