SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012013 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012013
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 8.24e-168
Family Phosphoglycerate kinase 0.00000000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012013   Gene: ENSTBEG00000013884   Transcript: ENSTBET00000013867
Sequence length 417
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4383:119127:120380:1 gene:ENSTBEG00000013884 transcript:ENSTBET00000013867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKLDVKGKRVIMRVDFNVPMKKNQITNNQRIKAAIPSIKYCLDNEAKSVVL
MSHLGRPDGVPMPDKYSLEPVAAELKSLLGRDVLFLKDCVGSEVEKACANPATGSVILLE
NLRFHVEEEGKGQDPSGKKLKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKASGFLMKKELDYFARALENPERPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVNDIMAKANKNGVKITFPVDFVTADKFDENAKVGQ
ATVASGVPPGWMALDCGPETNKKFAQVVAQAKLIVWNGPVGVFEWEAFAKGTKALMDEVV
KATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVDALSNL
Download sequence
Identical sequences ENSTBEP00000012013 ENSTBEP00000012013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]