SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012467 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012467
Domain Number 1 Region: 59-155
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.11e-16
Family Glyoxalase I (lactoylglutathione lyase) 0.00000598
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012467   Gene: ENSTBEG00000014386   Transcript: ENSTBET00000014382
Sequence length 155
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3492:677134:707597:-1 gene:ENSTBEG00000014386 transcript:ENSTBET00000014382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPQPCGLTDEAALSCCCDADPSTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLQK
FDFPTMKFSLYFLAYEDKNDIPQNRDEKVAWVFSRKATLELTHNWGTEDDKTQNYHNGNS
DPRGFGHIGIAVPDVHGACARFEQLGVKFVKKPDD
Download sequence
Identical sequences ENSTBEP00000012467 ENSTBEP00000012467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]