SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012512 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000012512
Domain Number - Region: 140-193
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00562
Family DeoB catalytic domain-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012512   Gene: ENSTBEG00000014433   Transcript: ENSTBET00000014429
Sequence length 294
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4927:29593:41865:1 gene:ENSTBEG00000014433 transcript:ENSTBET00000014429 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSWPGLAVGNLFHRPRATVMVMVKGVDKLALPPGSVISYPLENAVPFSLDSVANSIHSL
FSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLNSLPLNSLSRN
NEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDA
SKILADALQKFADDMYNLYGGNAVVELVTVKSFDTSLVRKTRTILEAKQAKTSTSPYNLA
YQYNFEYSVVFNMVLWIMIALALAVIVTSYNIWNMDPGYDSIIYRMTNQKIRMD
Download sequence
Identical sequences ENSTBEP00000012512 ENSTBEP00000012512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]