SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012632 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012632
Domain Number 1 Region: 26-82
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.000000000000188
Family Leucine zipper domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012632   Gene: ENSTBEG00000014581   Transcript: ENSTBET00000014564
Sequence length 125
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2755:136097:157462:1 gene:ENSTBEG00000014581 transcript:ENSTBET00000014564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHSSDSSDSSFSRSPPPGKQDSSDDVRKVQRREKNRIAAQKSRQRQTQKADTLHLESED
LEKQNAALRKEIKQLTEEMKYFTSVLSSHEPLCSVLASSTPSPPEVVYSAHAFHQPHVSS
PRFQP
Download sequence
Identical sequences A0A250Y9I2 L9JGZ6
XP_006157099.1.99106 XP_020018894.1.5219 ENSTBEP00000012632 ENSTBEP00000012632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]