SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012815 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012815
Domain Number 1 Region: 25-278
Classification Level Classification E-value
Superfamily Carbonic anhydrase 3.4e-59
Family Carbonic anhydrase 0.0000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012815   Gene: ENSTBEG00000014774   Transcript: ENSTBET00000014768
Sequence length 307
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3425:163093:643595:-1 gene:ENSTBEG00000014774 transcript:ENSTBET00000014768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPF
LTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQ
GSEHLLNGQAFSGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSDSSNPFLNRMLN
RDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITR
MQMHSLRLLSQNQPSQIFLSMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYR
VNEWLLK
Download sequence
Identical sequences ENSTBEP00000012815 ENSTBEP00000012815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]