SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013138 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013138
Domain Number 1 Region: 576-711
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.13e-39
Family Mannose 6-phosphate receptor domain 0.00024
Further Details:      
 
Domain Number 2 Region: 1464-1595
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 9.03e-36
Family Mannose 6-phosphate receptor domain 0.000000143
Further Details:      
 
Domain Number 3 Region: 712-873
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.54e-33
Family Mannose 6-phosphate receptor domain 0.0017
Further Details:      
 
Domain Number 4 Region: 446-567
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.01e-28
Family Mannose 6-phosphate receptor domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1042-1170
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 7.33e-28
Family Mannose 6-phosphate receptor domain 0.0011
Further Details:      
 
Domain Number 6 Region: 1174-1311
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 2.49e-25
Family Mannose 6-phosphate receptor domain 0.00036
Further Details:      
 
Domain Number 7 Region: 2109-2227
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.4e-24
Family Mannose 6-phosphate receptor domain 0.0012
Further Details:      
 
Domain Number 8 Region: 1729-1843,1891-1936
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.54e-24
Family Mannose 6-phosphate receptor domain 0.0042
Further Details:      
 
Domain Number 9 Region: 1367-1458
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 6.54e-24
Family Mannose 6-phosphate receptor domain 0.001
Further Details:      
 
Domain Number 10 Region: 1934-2053
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.83e-22
Family Mannose 6-phosphate receptor domain 0.0036
Further Details:      
 
Domain Number 11 Region: 1-88
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 5.76e-19
Family Mannose 6-phosphate receptor domain 0.0000106
Further Details:      
 
Domain Number 12 Region: 1841-1892
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-16
Family Fibronectin type II module 0.0012
Further Details:      
 
Domain Number 13 Region: 209-268
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000314
Family Mannose 6-phosphate receptor domain 0.000048
Further Details:      
 
Domain Number 14 Region: 882-945
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.000000000693
Family Mannose 6-phosphate receptor domain 0.0093
Further Details:      
 
Domain Number 15 Region: 1599-1664
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000249
Family Mannose 6-phosphate receptor domain 0.0029
Further Details:      
 
Domain Number 16 Region: 354-389
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 0.0000000366
Family Mannose 6-phosphate receptor domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013138   Gene: ENSTBEG00000015032   Transcript: ENSTBET00000015137
Sequence length 2439
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5449:68752:145089:1 gene:ENSTBEG00000015032 transcript:ENSTBET00000015137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YTWEAVDTKNSILYKINLCGNVGITECGPSSAVCLHNLKTNNYQSVGDSALKSATRSLLE
FNTTLSCRQQSTNHKVQSSITFLCGKTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVLSYGKEEAGRLDFCDGHSPAVTITFICPS
ERREGTIPKLTASSNCRYEVEWVTEYACHRDYLESQSCTLSSEQHDVAIDLSPLAQXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSDGDL
TLIYFGGEECSSGFQRMSVINFECNQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXSEQNWEAVDGSQTETEKKHFFINVCHRVLQGGEARG
CPEEAAACAVDKNGSKNLGKFISSPTKEKGNIQLSYSDGDTCGQDKKIKTNITLICKPGD
LESAPVLRTSGDDGCFYEFEWHTAAACVLSRTEGENCTVFDSQAGFSFDLSLLTKKNGAY
RVETEKYDFYINVCGPVSASPCPPDAGACQVAKSDRKAWNLGLSNARLSYYDGMVQLSYK
DGTPYNNEKHTPRATLITFLCDREAGVGFPEYQEEDNSTYNFRWYTSYACPEEPLECVVT
DPSTSEQYDLSSLAKSEGGRGGNWFAMDNSGEHVTWRKYYINVCRPLNPVPGCDRYASAC
QMKYKKDQDSFAETVSISNLGMAKTGPVVEESGSLLLEYVNGSACTTSDGRLTTYTTRIH
LVCARGSLSSHPIFSLNWECVVSFLWNTEAACPVQTMTDTDQACSIRDPNSGFVFNLSPL
NSSQGYVVSGIGKTFVFNICGTMPACGTVEDGKPASGCEAETQTEELKNLKPERPVGFEK
SLQLSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXAAGNEYDLSGLSTARKPWTAVDTSAEGKKRTFYLSVCNPLS
YIPGCRGSAVGSCLVSEDNSWNLGVVQISPQAAVNGSLSIVYVNGDRCGNRRFSTRITFE
CAQITGSPTFQKLLDDCEFVFVWRTVEACPVLRVEGDNCEVRDPRHGNLYDLKPLAFNDT
VVSAGEYTYYFRVCGKLSSGICPTDDRTHAVSSCQEKRGPQGFQKVAVVPTLKVIGNGLK
INYTGGDTCHKVSQRYTAYFFRTRGTPQPVFLRETSDCSYLFEWRTQHACPPFDLTECSY
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPCPPEAAVCLLNG
SKPLNLGRVRDGPQWRDGATVIVYVDGDLCPDQIRKRSTTIRFSCSESQVNSRPMFISAV
EDCEYTFSWPTAAACPVKSNVHDDCQVTNPSTGHLFDLSSLSGRAGFTAAYSEKGLVYMS
ICGENENCLPGVGACFGQTRISVGKASKRLTYVDQILQLVYEDGSPCPSKSGLSYKSVIS
FVCRPEAGPTNRPMLISLDKQTCTLFFSWHTPLACEQATECSVRNGSSIIDLSPLIHRTG
YKAYDESEDGASDTNPDFYINICQPLNPMHGVPCPAGAAVCKVPVSGPPIXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPKLLRTSDCDFVFLWETP
IVCPDEVKTEGCALTDEQLLYSFNLSSLSRSTFKVTRDSRTYSVGVCAAAAGPDQGGCKD
GGVCLLSGSKGASFGRLQSMRLDYRHQDEAVILSYVNGDFCPPETDEGDPCVFPFLFNGK
SYEECVVESRAKLWCATTANYDRDHEWGFCRHTNSHRTSAIIFKCDEDEDIGRPQVFSEV
RGCEVTFEWKTKVVCPPKKMECKFVQKHKTYDLRLLSSLTGSWVVGHEGATYYINLCQKV
YKGPLGCSERASICKKSASGNIQVLGLVHTQKLDVKDDRVVVTYSKGYSCGGNKTASSVI
ELTCAKTVGRPSFSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLFSASGDMRTNGDSYLYEIQLSSITSSTNPACFGANICQVKPNDQRFSRKVGTSDK
TKYYVQDGDLDVVFASSSKCGKDKTKSVSSTIFFHCDPLVKDGIPEFSHETADCQYLFSW
YTSAVCPLGMSFDGDSAAGDGQAYKGLSERSQAVGAILSLLLVALTGCLLALLLYKKERR
ETVINRLTGCCRRSSHVSYKYSKVNKEEETDENETEWLMEEIQLPAPRAGKEGQENGHIT
TKSVKAEALTSLHGDDQDSEDEVLTIPEVKVHSGRGAGAESSHLARNPPRKALREREDSR
ARPTRGGPESRARPRAGQPPPSTKLVSFHDDSDEDLLHI
Download sequence
Identical sequences ENSTBEP00000013138 ENSTBEP00000013138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]