SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013199 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013199
Domain Number 1 Region: 107-227
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000491
Family Glyoxalase I (lactoylglutathione lyase) 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000013199
Domain Number - Region: 8-98
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.00293
Family Glyoxalase I (lactoylglutathione lyase) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013199   Gene: ENSTBEG00000015200   Transcript: ENSTBET00000015205
Sequence length 264
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5258:307827:376775:-1 gene:ENSTBEG00000015200 transcript:ENSTBET00000015205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEYPRNTEGSFSKPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGNDFMGVTLASS
QAVSNARKLQWPLTEVAEGVFETEAPGGYKFYLQDRNLPQSDPVLKVTLAVSDLQKSLNY
WSNLLGMKIYEKDEEKQRALLGYADNQCKLELQCIKGAVDHAAAFGRIAFSCPQKELPGL
EDLMKREKQKILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKVDPGGRQM
MDDAMAADKSDEWFAKHRKPKASG
Download sequence
Identical sequences ENSTBEP00000013199 ENSTBEP00000013199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]