SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013250 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013250
Domain Number 1 Region: 65-298,365-503
Classification Level Classification E-value
Superfamily ALDH-like 5.29e-103
Family ALDH-like 0.0000000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013250   Gene: ENSTBEG00000015268   Transcript: ENSTBET00000015272
Sequence length 507
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_681:215848:300123:1 gene:ENSTBEG00000015268 transcript:ENSTBET00000015272 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRLDHRLLSAATTQSVPAPNQQPEVSTKQIFIDNEWHDAISKKTFPTVNPSTGEVICQVA
AGDKEDVDKAVKAARAAFQLGSPWRRMDASDRGRLLYRLADLIERDRTYLAXXXXXXXXX
XXXXXXXXXXXXXXXXXXYYAGWADKYHGKTIPIDGDFFSYTRHEPVGVCGQIIPWNFPL
LMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVNIVPGFGPTAGAAI
ASHDDVDKVAFTGSTEVGHLIQIAAGKSNLKRVTLELGGKSPNIIMSDADXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDETQFKK
ILGYIQSGKQEGKLLCGGGPAADRGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTI
EEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGS
GRELGEYGLQAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences ENSTBEP00000013250 ENSTBEP00000013250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]