SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013390 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013390
Domain Number 1 Region: 43-116
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.88e-17
Family Ribosomal protein L11, C-terminal domain 0.0041
Further Details:      
 
Domain Number 2 Region: 1-54
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.0000000000589
Family Ribosomal L11/L12e N-terminal domain 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013390   Gene: ENSTBEG00000015443   Transcript: ENSTBET00000015433
Sequence length 134
Comment pep:novel scaffold:TREESHREW:scaffold_110654:69883:70383:1 gene:ENSTBEG00000015443 transcript:ENSTBET00000015433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPKFDPNEIKVVYLRCTSGEVGALSALAPKIGPLVLLIEVVPSASVLIIKALKEPPRDR
KEQKNIKHSGYITFDEIVSIAQQMRHQSLARELTGTIKEVPGTAQSVGCNVDGRHPHDII
NDINSGAVECPAGE
Download sequence
Identical sequences ENSTBEP00000013390 ENSTBEP00000013390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]