SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013409 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013409
Domain Number 1 Region: 13-87,130-163,202-296
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.28e-28
Family Quinoprotein alcohol dehydrogenase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013409   Gene: ENSTBEG00000015441   Transcript: ENSTBET00000015454
Sequence length 348
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3266:488009:510223:1 gene:ENSTBEG00000015441 transcript:ENSTBET00000015454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMRQTPLTCSGHTRPRVNLAFSGITPYGFLISCKDGKPMLRQGDTGDWIGTFLGHKGAV
WGATLNKDATKAATAAADFTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXPMEISGHTSGIKKALWCSEDKQILSADDKTVRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXEILVITYGRSIAFHSAVSLDPIKSFEAPATINSASLHPEKEFLVAGG
EDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELYASGSEDGTLRLWQTVVGKTYGL
WKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDSIYSSTPEVKA
Download sequence
Identical sequences ENSTBEP00000013409 ENSTBEP00000013409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]