SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013421 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013421
Domain Number 1 Region: 320-422
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.72e-28
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0029
Further Details:      
 
Domain Number 2 Region: 48-109
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000523
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 
Domain Number 3 Region: 131-185
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000963
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013421   Gene: ENSTBEG00000015444   Transcript: ENSTBET00000015467
Sequence length 701
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_637:379116:555354:1 gene:ENSTBEG00000015444 transcript:ENSTBET00000015467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASDIPGSVTLPVAPMAASGQVRMAGALPARGGKRRSMDFDDDGEPSKSRENHSEIERRR
RNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGNKSTDGAYKPSFLTE
QELKHLILAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGSTLYEQVHPDDVEKLR
EQLCTSENSMTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGNAPLDHLPLNRI
TTMRKRFRNGLGPVKDGEAQYAVVHCTGYIKAWPPAGMTIPEEDAEVGQGSKYCLVAIGR
LQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGYQPQDLLGKDILEFCHP
EDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQNPYSDEIEYIICTNT
NVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXEKKMMSSASAAGSQQIYSQGSPFPPGHSGKAFSSSVVHVPGVNDIQSSSST
GQSMSQISRQLNQGQVAWTGSRPPFPGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences ENSTBEP00000013421 ENSTBEP00000013421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]