SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013427 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013427
Domain Number 1 Region: 73-321
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 5.89e-76
Family Creatinase/aminopeptidase 0.00000218
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000013427
Domain Number - Region: 4-40
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00401
Family MYND zinc finger 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013427   Gene: ENSTBEG00000015469   Transcript: ENSTBET00000015475
Sequence length 322
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3252:129103:181106:1 gene:ENSTBEG00000015469 transcript:ENSTBET00000015475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDGCSSEAKLQCPTCIKLGIQGSYFCSQECFKGSWATHKLLHKKAKDEKAKREVSSWTVE
GDINTDPWAGYRYTGKLRPHYPLMPTRPVPSYIQRPDYADHPLGMSESEQALKGTSQIKL
LSSEDIEGMRLVCRLAREVLDIAAGMIKPGVTTEEIDHAVHLACIARNCYPSPLNYYNFP
KSCCTSVNEVICHGIPDRRPLQEGDIVNVDITLYRNGYHGDLNETFFVGEVDEGARKLVQ
TTYECLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVRSYCGHGIHKLFHTAPNVPHYA
KNKAVGVMKSGHVFTIEPMICE
Download sequence
Identical sequences ENSTBEP00000013427 ENSTBEP00000013427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]