SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013511 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013511
Domain Number 1 Region: 5-183
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.46e-30
Family UbiE/COQ5-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013511   Gene: ENSTBEG00000015579   Transcript: ENSTBET00000015565
Sequence length 194
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6148:87274:89115:1 gene:ENSTBEG00000015579 transcript:ENSTBET00000015565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESKKRELFDQIKALTGASGKVALLELGCGTGANFQFYPPGCRVTCVDPNPHFEKFLTKS
MAENRHLHYERFVVAHGEDMKQLADGSMDAVVCTLVLCSVQSPRRVLQEVQRVLRPGGVL
FFWEHVAEPRGSWAFMWQQVLEPTWKHIGDGCHLTRETWKDLENARFSEVQMERQPPPFK
WLPVGPHIMGKAVK
Download sequence
Identical sequences ENSTBEP00000013511 ENSTBEP00000013511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]