SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013523 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013523
Domain Number 1 Region: 148-321
Classification Level Classification E-value
Superfamily vWA-like 6.99e-54
Family Integrin A (or I) domain 0.00000345
Further Details:      
 
Domain Number 2 Region: 643-714
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000837
Family Integrin beta tail domain 0.0087
Further Details:      
 
Domain Number 3 Region: 44-99
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000455
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 602-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family Integrin beta EGF-like domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013523   Gene: ENSTBEG00000015560   Transcript: ENSTBET00000015577
Sequence length 797
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2733:80857:97449:-1 gene:ENSTBEG00000015560 transcript:ENSTBET00000015577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSIVFVFLLALSRGESELDAKIPSPGEATQQEDPDLSLRGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCGRREELLARGCPLQELEEPRGWQDVLQDEPLSQGDRGEGA
TQLAPQRVRITLRPGETQQLRVRFLRAAGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
QLQKVTDSVRIGFGSFVDKTVLPFVSTVPAKLRHPCPTRLEPCQPPFSFRHVLSLTDNAQ
DFEREVGRQSVSGNLDSPEGGFDAILQAALCQKQIGWKNVSRWLVFTSDDTFHTAGDGLG
GIIIPSDGHCHLDSIGLYSRSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRACECSGD
VDNCVSSEGGHCSGHGYCKCNRCQCTEGYYGALCDQCSGCKTPCETHRDCAECGAFGTGP
LATNCSMACAHANVTLDLTPVLDDGWCKERTLDNKLFFFLVTNEAGGRVLLRVKPQEQGA
DHTQAVVLGCIGGIVAVGLVLVLAYRLSVEIYDRREYSRFEKERQQLNWKQDNNPLYKSA
ITTTINPRFQEADDPPF
Download sequence
Identical sequences ENSTBEP00000013523 ENSTBEP00000013523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]