SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013610 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013610
Domain Number 1 Region: 358-499
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.14e-38
Family Eukaryotic proteases 0.00048
Further Details:      
 
Domain Number 2 Region: 197-295
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-27
Family Kringle modules 0.00083
Further Details:      
 
Domain Number 3 Region: 39-90
Classification Level Classification E-value
Superfamily Kringle-like 5.54e-18
Family Fibronectin type II module 0.0049
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000177
Family EGF-type module 0.031
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000013610
Domain Number - Region: 177-206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00628
Family EGF-type module 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013610   Gene: ENSTBEG00000015657   Transcript: ENSTBET00000015679
Sequence length 501
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2237:10615:22945:-1 gene:ENSTBEG00000015657 transcript:ENSTBET00000015679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALLLLGSLLASLGAALSTPPWKAPKQHKQKASEPTAVLTVTGEPCHFPFQYHRQLYYK
CTHRGQPGPQPWCATTPNFDRDRRWAYCMEPKNMKDHCSKHNPCRKGGTCVSVPSGPRCL
CPEHLTGKHCQREKCFEPQLLRFFHEDEIWHRAEPGGVARCQCRGPDAHCRRLASQACST
NPCLNGGRCIAAQGQRLCHCPAGYTGPFCDVDTQQSCYHDRDRGLSYRGMAGTTLSGAAC
QRWVSEATYWNATAELALSWGLGDHAFCRNPGNDSRPWCFVLGDRLTWEYGMPQCPPPSG
AARVPARSRVQELPLAALSQQHRLGPTTGAPQSQTPDTSRTRDGPVSCGQRLRKRLSSLS
RVVGGLVALPGSHPYIAALYWDQSFCAGSLIAPCWVLTAAHCLQSRPAPELLTVVLGQDR
HNQSCEQCQALAVRSYRLHEDFSPISYQHDLALLRLQESADGSCALLSPYVQPVCLPSDA
NPPAESDAALCEVAGWGHQFE
Download sequence
Identical sequences ENSTBEP00000013610 ENSTBEP00000013610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]