SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013948 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013948
Domain Number 1 Region: 332-421
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00057
Further Details:      
 
Domain Number 2 Region: 158-210
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000066
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.027
Further Details:      
 
Domain Number 3 Region: 53-112
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000851
Family HLH, helix-loop-helix DNA-binding domain 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013948   Gene: ENSTBEG00000016041   Transcript: ENSTBET00000016058
Sequence length 918
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3256:50:843615:1 gene:ENSTBEG00000016041 transcript:ENSTBET00000016058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPRPHFQQGSIRGDGITAQHPLPNQSECRKIYRYDGIYCESTYQNLQALRKEKSRDAA
RSRRGKENFEFYELAKLLPLPAAITSQLDKASIIRLTISYLKMRDFANQGDPPWNLRMEG
PPPNTSVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLDGFVFALNQEGKFLYISETVSI
YLGLSQVELTGSSVFDYVHPGDHVEMAEQLGMKLPPGRGLLSQGTAEDGASSASSSSQSE
TPEPVESTSPSLLTTDNTLERSFFIRMKSTLTKRGVHIKSSGYKVIHITGRLRLRVSLSH
GRTVPSQIMGLVVVAHALPPPTINEVRIDCHMFVTRVNMDLNIIYCENRISDYMDLTPVD
IVGKRCYHFIHAEDVEGIRHSHLDLLNKGQCVTKYYRWMQKNGGYIWIQSSATIAINAKN
ANEKNIIWVNYLLSNPEYKDTPMDIAQLPHLPEKTSESSETSDSESDSKDTSGITEDNDN
SKSDEKGNQSENSEDPEPDRKKSGNACDNDMNCNDDGHSSSNPDSRDSDDSFEHSDFENP
KAGEDGFGALGPMQIKVERYVESESDLRLQNCESLTSDSAKDSDSAGEAGAQASSKHQKR
KKRRKRQKGGSASRRRLSSASSPGGLDAGLVKPPLLSSPNSASVLKIKTEISEPINFDND
SSIWNYPPNREIRNESPYSMTKPSEHFPSPQGGGGGLHVAIPDSVLTPPGTDGAATRKTQ
FSASATAALAPVASDPLSPPLSASPRDKHPGGGGGGSGGSAGPSASNSLLYTGDLEALQR
LQAGNVVLPLVHRVTGTLAATSTAAQRVYTTGTIRYAPAEVTLAMQGNLLPNAHAVNFVD
VNSPGFGLDPKTPMEMLYHHVHRLNMSGPFGGAVSAASLTQMPAGNVFTTAEGLFSTLPF
PVYSNGIHAAQTLERKED
Download sequence
Identical sequences ENSTBEP00000013948 ENSTBEP00000013948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]