SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014113 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014113
Domain Number 1 Region: 2-347
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 5.49e-73
Family ADP-ribosylglycohydrolase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014113   Gene: ENSTBEG00000016250   Transcript: ENSTBET00000016242
Sequence length 357
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_137943:15948:20483:1 gene:ENSTBEG00000016250 transcript:ENSTBET00000016242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VERYVAAMVLSAAGDALGYFNAKWEFLRDGEKIHKQLAQLGGLDAIDVGRWRVSDDTVMH
LATAEALVEAGPAPNLARLYSLLAKHYQDCMEDMGGRQPGGASVQNAMLLEPDKVNGWRI
PFNNHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTT
YAVNGKPPEQWGKGLMEVLPEAKKYIEQSGYFVEENLQHWSYFQNQWEKYLKLRGILEGK
SAPIFPKSFNVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAILAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVLHGFKGVSPSNYEKLEYRSRLEETAKALYALGSKEDTVVTL
Download sequence
Identical sequences ENSTBEP00000014113 ENSTBEP00000014113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]