SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014191 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014191
Domain Number 1 Region: 266-512
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-89
Family ALDH-like 0.00000000047
Further Details:      
 
Domain Number 2 Region: 122-186
Classification Level Classification E-value
Superfamily ALDH-like 0.0000000000034
Family ALDH-like 0.0000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014191   Gene: ENSTBEG00000016324   Transcript: ENSTBET00000016328
Sequence length 517
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2126:132666:327234:-1 gene:ENSTBEG00000016324 transcript:ENSTBET00000016328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSKIEMPGEVKADPAALMASLHLLPSPTPNLEIKYTKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XTMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGMTIPVDGDYFTFTRHEPIGVC
GQIIPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADAD
LDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQG
PQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFG
VQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQS
PFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSTBEP00000014191 ENSTBEP00000014191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]