SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014294 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000014294
Domain Number - Region: 116-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0418
Family VPS37 C-terminal domain-like 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014294   Gene: ENSTBEG00000016458   Transcript: ENSTBET00000016447
Sequence length 355
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5928:194605:200809:-1 gene:ENSTBEG00000016458 transcript:ENSTBET00000016447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLKDKTLQELEEMQNDPEAINRLALESPEVQDLQLEREMALATNRSLAERNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMAE
KFLEGEVPLETFLENFSSMRMLSHLRRVRVEKLQDVVRKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSMPVGPTAHGALQPAPFPVVSQPSFYSGP
VGPGHSSAQPGSQAAAGYSWSPQRSTPPRPGYPVAPTGASGPGYPVAGGRAPSPGYPQQS
PYLPTGGKPPYPTQPQLPGFPGQPQPSFPPQPPYPPGPAPPYGFPPPQGPVWPGY
Download sequence
Identical sequences ENSTBEP00000014294 ENSTBEP00000014294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]