SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014578 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014578
Domain Number 1 Region: 1194-1374,1419-1580
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-75
Family YicI catalytic domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 320-445,532-698
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.41e-65
Family YicI catalytic domain-like 0.0027
Further Details:      
 
Domain Number 3 Region: 76-319
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 9.42e-42
Family YicI N-terminal domain-like 0.0052
Further Details:      
 
Domain Number 4 Region: 958-1190
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.71e-41
Family YicI N-terminal domain-like 0.0058
Further Details:      
 
Domain Number 5 Region: 1583-1663
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.39e-17
Family Putative glucosidase YicI, domain 3 0.015
Further Details:      
 
Domain Number 6 Region: 912-970
Classification Level Classification E-value
Superfamily Trefoil 0.0000000000436
Family Trefoil 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000014578
Domain Number - Region: 738-780
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0611
Family alpha-Amylases, C-terminal beta-sheet domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014578   Gene: ENSTBEG00000016662   Transcript: ENSTBET00000016763
Sequence length 1780
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_699:41279:164750:-1 gene:ENSTBEG00000016662 transcript:ENSTBET00000016763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARRSEVTLIVLFAIVTIIAAVVVLATKTPATEASPTSNPATTTDPSSSGRCPNEINDPIN
ERINCIPEQFPTQALCAQRGCCWRPWNSSVIPWCFFVNNHGYNAEGLRTTNTGLEANLNR
ISSPTLFGNDINRVLFTTQNQTPNRFRFKXXXXXXXXXXXXXXXXXXXXXXXXXDTLYNV
QVTERPFGIKVIRRSNNRVLFDTSVGPLVYSNQYLQISAKLANEYIYGIGEHIHKRFRHD
LNWKTWPIFTRDQLPGDNNNNLYGHHTFFMCIEDVSGRSFGVFLMNSNAMEIFIQPTPIV
TYRVTGGILDFYIFLGDTPEQVVQQYQQLIGLPAMPAYWSLGFQLSRWNYNSLEVVREVV
RRNREAGIPFDTQVTDIDYMEDKKDFTYDAVQFNGLPEFVQDLHDHGQKYVIILDPAISI
GRRANGAAYETYERGNTQHVWVNESDGRTPIVGEXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXILDKLMYSKTICMDAVQNW
GRQYDVHSLYGYSMAIATEKAVERVFPNKRSFILTRSTFAGSGRHAAHWLGDNTASWEQM
EWSITGMLEFGLFGIPLVGADICGFVADTTEELCRRWMQLGAFYPFSRNHNADGYVPQDP
AYFGQNSLLVNSSRHYLTIRYTLLPFLYTLFYKAHRYGETVARQFLHEFYEPNSWIEXXX
XXXXXXXXXXXXXXXGAETVSAYIPDATWYDYETGAKRPWRKQRIDMHLPADKIGLHLRG
GYIIPIQEPDVTTTASRRNPLGLIVALNDDNTAQGDFFWDDGETKXXXXXXXXXXXXXXX
XXNNLAITCTHSSYPEGTSLAFESIKVLGVTDTVTQVTVAEANQQMSAHGNFTYDPSNQI
LLISNLQFNLGRNFTVQWNQVFLDSERFTCYPDADLATEAKCLQRGCVWETATSDFRAPE
CYFPKQDNPYSVNSIQYSSTGVTADLSYNSANARIQLPSVPIQALRVEVKYHKNDMLQFK
IYDPQNKRYEVPVPLNIPATPTSTYENRLYDVEIKENPFGIQIRRRSSGRVIWDTRRPGF
AFNDQFIQISTFLPSKYIYGFGEVNTRTFKQDLNLANIGEMFTRDQAPGYKLNSYGFHPY
HMTLEEEGNAHGVLLLNSNGMDVTFQPTPSLTYRIIGGILDFYMFLGPTPEVATQQYHEV
IGHPVMPPYWALGFQLCRYGYRNTSEVEQVYNEMVAAQIPYDVQYTDIDYMERQLDFTIG
ERFSDLPQFVDRIRGEGMRYIIILDPAISGNETQPYPAFERGLEKDVFVKWPNTNDICWA
KWVNSLYTINASRAHVAFPDFFRNSTAEWWAREILDFYNDRMKFDGLWIDMNEPSSFVNG
TTSNQCRNSQLNFPPYFPELTKRTDGLHFRTMCMETEQILSDGSSVLHYDVHNLYGWSQI
KPTYDALQKTTGKRGIVISRSTYPTGGRWGGHWLGDNYANWNNLDKSIIGMMEFSLFGIS
YTGADICGFFNNSEYQLCTRWMQLGAFYPYSRNHNIANTRRQDPASWNETFANMSRNILN
IRYTLLPYFYTQMHEVHAHGGTVIRPLLHEFFDERPTWDIFKQFLWGPAFMVTPVLEPNV
ETVEGYVPNARWFDYHTRQDIGIRGQSHLFDAPYDTINLHVRGGHILPCQEPAQNTFYSR
QNYMKLIVAADDNQMAQGTLFWDDGDSIDTYERSQYILIQFNLNQTTLTSTIVENGYINK
NEMRLGLIEIWGRGNSAVSQVNLQYNGNKNQLAFGQNKAT
Download sequence
Identical sequences ENSTBEP00000014578 ENSTBEP00000014578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]