SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014580 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014580
Domain Number 1 Region: 352-487
Classification Level Classification E-value
Superfamily C-type lectin-like 2.92e-34
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 2 Region: 210-347
Classification Level Classification E-value
Superfamily C-type lectin-like 5.06e-32
Family C-type lectin domain 0.00071
Further Details:      
 
Domain Number 3 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.16e-26
Family Cysteine rich domain 0.005
Further Details:      
 
Domain Number 4 Region: 635-792
Classification Level Classification E-value
Superfamily C-type lectin-like 2.72e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 949-1020,1168-1219
Classification Level Classification E-value
Superfamily C-type lectin-like 3.78e-19
Family C-type lectin domain 0.011
Further Details:      
 
Domain Number 6 Region: 501-625
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-19
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 7 Region: 1564-1661
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-16
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 8 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000171
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 9 Region: 1392-1454
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000449
Family C-type lectin domain 0.012
Further Details:      
 
Domain Number 10 Region: 1234-1316
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000455
Family C-type lectin domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014580   Gene: ENSTBEG00000016704   Transcript: ENSTBET00000016765
Sequence length 1719
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_2532:153503:375082:-1 gene:ENSTBEG00000016704 transcript:ENSTBET00000016765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTCWGTTCRPVELLLLLLGGFGVGEPPGPAGNDPFTIVNENTGKCIKPLYGWIVAEDCD
ETKDMLWKWVSQHRLFHLQSQKCLGLDITKPAESLRMFSCDSSAMLWWKCEHHSLYGAAQ
YRLALKDGHAIATTNTSDVWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLIDGTWH
HDCIFDENHSGPWCATTLNYEYDKKWGICLKPENGCKDNWEKNEQFGSCYQFNTQAALSW
KEAYVSCQNQGADLLSITSAAELTYLKEKEGIARIFWMGLNQLYSARGWDWSDHKPLYFL
NWDPAMPSAPTIGGSSCGRMDAESGLWQSFSCEAQLPYVCEKPLNNTVELADVWTYSDTH
CDAGWLPNNGFCYLLVNESDSWDNAQKKCRAFGTDLISIHSLADIEVVVTKLHNGDVKEE
TWIGLKNINVPALFQWSDGTEVTLTYWDENEPNLPYNKTPNCVSYLGKLGQWKVQPCEKK
LKYVCKKRGEKMNDTKSDKMCPPDEGWKRHGEACYKIYKDAVPFGTNCNLTITSRFEQEY
LNDMMKKYDKSLGKYFWTGLADVDSRGEYSWATVGGTKQAVTFSNWNLLEPASPGGCVAM
STGKSLGKWEVKDCRSFRALSICKKISGPLKPEEVAPKPDSPCPEGWHTFPSSLSCYKVF
HIERIVRKRNWEEAERFCQALGAHLPSFSHADKIKEFLHLVTDQFSGQRWLWIGLNKRSP
DLHGSWQWSDFTPVSTIVMENEFQQDYDVRDCAAVKVIHRPWRRGWHFHDDREYSYFRPF
ACDTKLEWVCQIPKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXINKPADCSTKLPFICEKYNVSSLEKYSPDSAAKVQCSGSWIPFQN
KCFLKITPKSLTFSQASDTCHSYGGTLPSVLSQSEQDFITSLLPDMEATLWIGLRWTAHE
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFEGTQTLQNTSETVKYGNNLYKIIPKALTWXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXDERFGSDGKRLRFSRWADNQQVEDCVILDTD
GFWKADCSDNQPGAICYYPGNETEKEVKPVDSVKCPSPVLNTPWIPFQNSCYNFMITKNR
HIATAQDEVHAKCQKLNPKSHILSIRDEKENNFVLEQLLYFNYMASWVMLGITYEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XDYKEEYNTTLPEFISYEDGIYNIIQKKITWYEALSICSKSGGYLASVHDQKCQLFLEDI
VKRDGFPLWVGLSSHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXHSATIVTIKDEDENKFVSRLMRENNNITMRVWLGLSQQMVDQSWNWLDGSKATFVKW
GNKSKSDNTGKCSILLASDETWKKVECSQGFGRVVCKVPLGPDYRGIAVTFAVLSVLALM
GGLIWFLFRWKRFHWAGFSSVRYEQGVNEDEIMLPSFHD
Download sequence
Identical sequences ENSTBEP00000014580 ENSTBEP00000014580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]