SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014593 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014593
Domain Number 1 Region: 429-759
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 2.47e-102
Family PDEase 0.00000148
Further Details:      
 
Domain Number 2 Region: 164-263
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 7.57e-18
Family Flavin-binding PAS domain 0.064
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000014593
Domain Number - Region: 36-109
Classification Level Classification E-value
Superfamily CheY-like 0.000916
Family CheY-related 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014593   Gene: ENSTBEG00000016756   Transcript: ENSTBET00000016781
Sequence length 770
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_135027:55897:163205:-1 gene:ENSTBEG00000016756 transcript:ENSTBET00000016781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVSSAEVRIGPMRLTQDPIQVLLIFAKEDSQSDGFWWACDRAGYRCNIARTPESALECFL
DKHHEIIVIDHRQTRNFDAEAVCRSIRATNPSEHTVILAVVSQASEDHEEASVLPLLHAG
FNRRFMENSSIIACYNELIQIEHGEVRSQFKLRACNSVFTALDHCHEAIEITSDDHVIQY
VNPAFERMMGYHKGELLGKELSDLPKSDKNRADLLDTINTCIKKGKEWQGVYYARRKSGD
SIQQHVKITPVIGQGGKIRHFVSLKKLCCTTDNNKIHKIHRDSGDNSQTEPHSFRYKNRR
KESIDVKSISSRGSDAPSLQNRRYPSMARIHSMTIEAPITKVINIINAAQENSPVTVAEA
LDRVLEILRTTELYSPQLGTKDEDPHTSDLVGGLMTDGLRRLSGNEYVFTKNVHQSHSHL
AMPITINDVPPCIAQLLDNEESWDFNIFELEAVTHKRPLVYLGLKVFSRFGVCEFLNCSE
TTLRAWLQVIEANYHSSNAYHNSTHAADVLHATAFFLGKERVKGSLDHLDEVAALIAATV
HDVDHPGRTNSFLCNAGSELAVLYNDTAVLESHHTALAFQLTVKDTKCNIFKNIDRNHYR
TLRQAIIDMVLATEMTKHFEHVNKFVNSINKPMAAETEGSDCECNPPGKNFLENQILIKR
MMIKCADVANPCRPLDLCIEWAGRISEEYFATDEEKRQGLPVVMPVFDRNTCSIPKSQIS
FIDYFITDMFDAWDAFAHLPALMQHLANNYKHWKTLDDQKCKSLRLPSDS
Download sequence
Identical sequences ENSTBEP00000014593 ENSTBEP00000014593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]