SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000014695 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000014695
Domain Number 1 Region: 10-135
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.55e-22
Family Antibiotic resistance proteins 0.099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000014695   Gene: ENSTBEG00000016917   Transcript: ENSTBET00000016904
Sequence length 138
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4414:48612:56793:1 gene:ENSTBEG00000016917 transcript:ENSTBET00000016904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRDSSETTSPCLINRLDHIVMTVKSIRDTTTFYSKTLGMEIXXXXGDRKALCFGNQKFNL
HEVGKEFEPKAAHPVPGSLDICLITEVPLEEIIQHLKACDVPIEEGPVPRTGAKGPIMSI
YFRDPDRNLIEVSNYISS
Download sequence
Identical sequences ENSTBEP00000014695 ENSTBEP00000014695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]