SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000015127 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000015127
Domain Number 1 Region: 89-258
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.36e-49
Family Mismatch glycosylase 0.00012
Further Details:      
 
Domain Number 2 Region: 355-491
Classification Level Classification E-value
Superfamily Nudix 1.45e-29
Family MutY C-terminal domain-like 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000015127   Gene: ENSTBEG00000017376   Transcript: ENSTBET00000017394
Sequence length 552
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5627:19418:30236:-1 gene:ENSTBEG00000017376 transcript:ENSTBET00000017394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRVRRLGRLRTIMRKPQAAVGSGHRKQVDSQKGRKRRALSSSQANPAPEGTIPECPWA
LVGLAGQQEAVVLQASVSPYHQFRDVAEVTAFRGSLLSWYDREKRDLPWRRLAEAEVDLD
RRAYAVWVSEVMLQQTQVATVINYYTRWMQKWPTLQDLASASLEEVNQLWAGLGYYSRGR
RLQEGARKVVEELGGHMPRTAETLQQLLPGVGRYTAGAIASIAFGQAAGVVDGNVVRVLC
RVRAIGADPSSTAVSQQLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXVEREQHSVSRSQPASPDVEECAPGAEQCQLCPPPTDPWDRTLGVTNFPRKASR
KPPREEYCATCVLEQPRALGGARILLVQRPNSGLLAGLWEFPSVALEPSGQHQHKALLQE
LQSWAGPLPASRLRHLGEVVHTFSHIKLTYHVYALALGGQTPVTTASPGARWLTREEFHA
AAVSTAMKKALVLLVFRLYEGQXXXXXXGSKRSHLSTPSNQKKPSPGQQVLDSFFRPLTP
PDAPNLSSAAQR
Download sequence
Identical sequences ENSTBEP00000015127 ENSTBEP00000015127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]