SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000004072 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000004072
Domain Number 1 Region: 906-1196
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.37e-76
Family Complement components 0.000035
Further Details:      
 
Domain Number 2 Region: 1278-1402
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 2.49e-26
Family Alpha-macroglobulin receptor domain 0.0028
Further Details:      
 
Domain Number 3 Region: 742-775
Classification Level Classification E-value
Superfamily E set domains 0.0000111
Family SVA-like 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000004072   Gene: ENSTBEG00000004665   Transcript: ENSTBET00000004728
Sequence length 1439
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_555:425369:593121:1 gene:ENSTBEG00000004665 transcript:ENSTBET00000004728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPRALTTAHLLCVCTAALAAVPGPRFLVTAPGIIRPGGNVTIGVELLEHGPSQITVKA
EVLKMASNLTVSVLAAEGVFEKGSFKTLVLPSXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPKSNLIQQWL
SQQNDLGVVSRTFQLSSHPILGDWSIQVQVNDQTYYQSFQVAEYVLPKFEVALQTPLYCS
LNSKHLNGTVTAKYTYGKPVKGDVTLTFLPLSFWGVKKNITKKFKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXAHFLDSVSSMAVHGMFTSPSKTYIQLKTRDDNIKVG
SPFELVVSGNKQLKELSYMVVSRGQLVAVGKQNSTTFSLTPENSWAPKACIIVYYVEDDG
EIINDVLKIPIQLVFKNEIKLFWSKANAEPSEKVSLRISVTQPESLVGIVAVDKSVNLMN
ASNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLAKDYIDGVYDTAEY
AQKFVEESEGYMVDIHDFSSGSNLHVRKHFPETWIWLDTKMGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXLQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XDILGPSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKRQLTDNLREKALSFMRQX
XXXXXXXQREKGFSAGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWIKGRQK
SNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQDSINFLESELSRG
ISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQQGEMQFWVSSVSTLSESWQPRSLDI
EVAAYALLSHFLQLQVSEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALMNTER
TNIHMTVMGPSSPRPVKFLVDTNNRLLLQTAELAVVQPTAVNISANGFGFAICQLNVIYN
VKDLGSSRRRRSIENQEDFDLDVAVEDNKDDINHVNLNVCTRFLSPSRGALMEVNLLSGF
TVSDAILLNYTVSKVESGHGKLNLYFDSVNETQFCVDIPAVRNFKVSNTQDASVSIVDYY
EPRRRAVRSYNSKVKLSSCDLCGDIQGCGPCEVGASGSLRYSSVVFLFCLMFLYLQHKL
Download sequence
Identical sequences ENSTBEP00000004072 ENSTBEP00000004072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]