SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007730 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007730
Domain Number 1 Region: 96-228
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.12e-37
Family Regulator of G-protein signaling, RGS 0.000000324
Further Details:      
 
Domain Number 2 Region: 792-848
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-16
Family DIX domain 0.0000831
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007730   Gene: ENSTBEG00000008910   Transcript: ENSTBET00000008918
Sequence length 849
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_6036:5:78688:-1 gene:ENSTBEG00000008910 transcript:ENSTBET00000008918 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARLTRGAVSTGVLGCSAQPKMSVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPA
SHSSCSGRGASAKGETSTATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGIG
LFRTFLKQEGCADLLDFWFACSGFRKLEPCDANEEKRLKLARAICRKYILDSSGIVSRQT
KPATRSFIKDCIVRQQVDPAMFDQAQTEVQAAMEDTYPSFLKSDMYXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXYGPWREPVPYYVSSGYALAATSADSEQQSLSSDADSLSLTDSSVDGVP
PYRTRRQHRREMQESMQANGRGPLPHIPRTYRVPKEIRVEPHKFAEELIHRLEAVQRTRE
AEERLEERLRRVRMEEEGEDGDLSPCPPGVSHKLPPAPTWHPFPPRYGDMGCAGLRDSHE
EDPEAILDEHVQRVLRTPGRQSPDSGHMAKGAAVLGGPTSGHSKHTPRSGPRLEAAGLHH
RHVHHHVHHSTARPKEQVEAEAARRVQGSFPWGPELYGHAAKPRSYPESMGAGAGDSLTH
SGKAGLPSRRGAKKADSGKSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSS
GVRKQPTHEGTRPLSVERPGAVHPWVSAQLRNSVQPSHLFIQDPAMPPNPAPNPLTQLEE
ARRRLEEEEKRASKLPSKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPQ
RKAGSGGAPPCDSIVVAYYFCGEPIPYRTLVRGRTVTLGQFKELLTKRGSYRYYFKKVSD
EFDCGVVFE
Download sequence
Identical sequences ENSTBEP00000007730 ENSTBEP00000007730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]