SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008803 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008803
Domain Number 1 Region: 362-763
Classification Level Classification E-value
Superfamily ALDH-like 5.5e-64
Family ALDH-like 0.000000896
Further Details:      
 
Domain Number 2 Region: 71-352
Classification Level Classification E-value
Superfamily Carbamate kinase-like 1.85e-38
Family PyrH-like 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008803   Gene: ENSTBEG00000010150   Transcript: ENSTBET00000010175
Sequence length 788
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_290:11764:71165:-1 gene:ENSTBEG00000010150 transcript:ENSTBET00000010175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSQVCRSGFQPFSRRLLSWAQSTAVSRSXXVQPSGIRHVRSWSNIPFITVPLSRTHGKS
FAHRSELKHAKRIVVKLGSAVVTRGDECGLALGRLASIVEQVSLQNQGREMMLVTSGAVA
FGKQRLRHEILLSQSVRQALHSGQNQLKEMAIPVLEARACAAAGQSGLMALYEAMFTQYS
ICAAQILVTNLDFHDEQKRRNLNGTLHELLRMNIVPIVNTNDAVVPPAEPNSDLQGVNVI
SVKDNDSLAARLAVEMKTDLLIVLSDVEXXXXXXXXXXXXXXXXXXXXXXXXXXXFGTKS
RVGMGGMEAKVKAALWALQGGTSVVIANGTHPKVSGHVITDIVEGKKVGTFFSEVKPAGP
TVEQQGEMARSGGRTLATLEPEQAAIHHLADLLTDQRDEILLANKKDLEEAEGRLAAPLL
KRLSLSTSKLNSLAIGLRQIAASSQDSVGRVLRRTRIAKNLELEQVTVPIGVLLVIFESR
PDCLPQVAALAIASGNGLLLKGGKEAAHSNRILHLLTQEALSIHGVKEAVQLXXXXXXXX
XXXXXXXXXXXXXXXXXSQLVRDIQKAAKGIPVMGHSEGICHMYVDSEASVDKVTRLVRD
SKCEYPAACNALETLLIHRDLLRTPLFDQIIDMLRVEQVKIHAGPKFASYLTFSPSEVKS
LRTEYGDLELCIEVVDSVQEAIDHIHKYGSSHTDVIVTENEKTAEFQHVDSCVFWNASSR
SDGYRFGLGAEVGISTSRIHARGPVGLEGLLTTKWLLRGQDHVVSDFSEHGSLKYLHENL
PVPQRTTN
Download sequence
Identical sequences ENSTBEP00000008803 ENSTBEP00000008803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]