SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009830 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009830
Domain Number 1 Region: 114-439
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-83
Family G proteins 0.00000147
Further Details:      
 
Domain Number 2 Region: 660-783
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.48e-39
Family Translational machinery components 0.00017
Further Details:      
 
Domain Number 3 Region: 443-568
Classification Level Classification E-value
Superfamily Translation proteins 8.17e-35
Family Elongation factors 0.00034
Further Details:      
 
Domain Number 4 Region: 838-915
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 9.11e-22
Family EF-G/eEF-2 domains III and V 0.00049
Further Details:      
 
Domain Number 5 Region: 585-658
Classification Level Classification E-value
Superfamily EF-G C-terminal domain-like 1.4e-17
Family EF-G/eEF-2 domains III and V 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009830   Gene: ENSTBEG00000011337   Transcript: ENSTBET00000011374
Sequence length 972
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1244:66589:105619:-1 gene:ENSTBEG00000011337 transcript:ENSTBET00000011374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDIGDHDDDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
Download sequence
Identical sequences ENSTBEP00000009830 ENSTBEP00000009830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]