SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011082 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011082
Domain Number 1 Region: 24-102
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 5.63e-28
Family Surp module (SWAP domain) 0.0000368
Further Details:      
 
Domain Number 2 Region: 136-216
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 3.16e-26
Family Surp module (SWAP domain) 0.0000049
Further Details:      
 
Domain Number 3 Region: 735-791
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.68e-16
Family Ubiquitin-related 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011082   Gene: ENSTBEG00000012771   Transcript: ENSTBET00000012790
Sequence length 793
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_778:104306:147143:-1 gene:ENSTBEG00000012771 transcript:ENSTBET00000012790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGPVQAVPPPPPVATEPKQPTEEEGASKEDSTPSKPVVGIIYPPPEVRNIVDKTASFV
ARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSAAIPKVMQQQ
QQATQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQ
FLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKXXXXXXXXXXXXXXXXXXXXXXX
XXVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTT
PEELGARILIQERYEKFGESEEVEMEVESDEEDEKQEKADEPPSQLDQDTQVQDMDEGSD
DEEEGQKVPPPPETPMPPPLPPTPDQVIVRKDYDPKASKPLPPAPAPDEYLVSPITGEKI
PASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVE
ETAIGKKIGEEEIQKPEEKVTWDGHSGSMARTQQAAQANITLQEQIEAIHKAKGLVPEDD
TKEKIGPSKPNEIPQQPPPPSSATNIPSSAPPITSVPRPPAMPPPVRTTVVSAVPVMPRP
PMASVVRLPPGSVIAPMPPIIHAPRINVVPMPPSAPPIMAPRPPPMIVPTAFVPAPPVAP
VPAPAPMPPVHPPPPMEDEPTSKKLKTEDSLMPEEEFLRRNKXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVSVIKVKIHEATGMPAGKQKLQYEGIFIKDSNSLAYYNMANGAV
IHLALKERGGRKK
Download sequence
Identical sequences ENSTBEP00000011082 ENSTBEP00000011082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]