SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000012705 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000012705
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily GroEL apical domain-like 1.52e-24
Family Group II chaperonin (CCT, TRIC), apical domain 0.0011
Further Details:      
 
Domain Number 2 Region: 210-261
Classification Level Classification E-value
Superfamily GroEL equatorial domain-like 0.000000000085
Family Group II chaperonin (CCT, TRIC), ATPase domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000012705   Gene: ENSTBEG00000014652   Transcript: ENSTBET00000014643
Sequence length 282
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_5913:121113:124514:1 gene:ENSTBEG00000014652 transcript:ENSTBET00000014643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVATQYFADRDMFCAGRVPEEDLKR
TMMACGGSIQTSVNALSADVLGSCQVFEETQIGGERYNXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGTWYGVDINNEDIADNFEAFVWEPAMVRIN
ALTAASEAACLIVSVDETIKNPRSTVDAPPAAGRGRGRGRAH
Download sequence
Identical sequences ENSTBEP00000012705 ENSTBEP00000012705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]