SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000013571 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000013571
Domain Number 1 Region: 2-411
Classification Level Classification E-value
Superfamily ALDH-like 3.53e-110
Family ALDH-like 0.000000000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000013571   Gene: ENSTBEG00000015634   Transcript: ENSTBET00000015632
Sequence length 491
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_442:30506:50781:1 gene:ENSTBEG00000015634 transcript:ENSTBET00000015632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPLRFRIQQLEALRRMVQEREKDILAAIAADLCKSEFNAYSQEVITVLGEIEHVLENLAE
WITAKPVKKNLLTMMDEAYIQPEPLGVVLIIGAWNYPFALTIQPLVGAIAAGNAVIVKPS
ELSDSTAKILAKLIPQYLDKDLYAVINGGVEETTELLKQRFDHILYTGNSVVGKIVMAAA
AKHLTPVTLELGGKSPCYIDRDCDLDTVCRRITWGKYMNCGQTCIAPDYILCEASLQSQI
VQKIKDTVKEFYGENIKESPDYERIINMRHFKRILSLLEGQKIAFGGETDEASRYIAPTI
LTDVDPDTKVMQEEIFGPILPIVPVKSVDEAIRFINDREKPLALYVFSRNDKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSSGMGAYHGKHSFDTFSHHRPCLLKSLKGEGANK
LRYPPNSQSKVDWTKFFLLKRFSKGKLGLLLLAFLGVLAAVLVKKSHAVLRRKALLTFLV
AHRLRRSREQR
Download sequence
Identical sequences ENSTBEP00000013571 ENSTBEP00000013571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]