SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385270186|ref|YP_005813346.1| from Chlamydia trachomatis A2497

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385270186|ref|YP_005813346.1|
Domain Number 1 Region: 167-200,234-316
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000138
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|385270186|ref|YP_005813346.1|
Sequence length 332
Comment hypothetical protein [Chlamydia trachomatis A2497]
Sequence
MKSRNAQSILESLCKKTHRLLLRYLLKQTLLVALGMTLMVAELGIFLYFFLFSGKTLLPA
FCLACFVLTIFICLVIRLYILSKKTEFFDKLLADFVHQAQVIFKKKNMMEEQPEIAAAVT
QLSLVMQNQEYFVFCNLLKIVPPYDSIKKFSCFCFWKDYFSFREMLLQKAIDLYLLVVQA
IPTDLGAHVSLADAYVSLSGLYADPRKYTEFDTKYWVPPGRYGEDIQEKFFATAHRATEE
FKILNEYAPGNVWVHTQLAYSYHDLQMPKKEIREYEIVLKLKPHDANTIMKLGILYFQQG
MNAKGLQVYEQLRKVDLKKSKKLIKFYGVVAK
Download sequence
Identical sequences A0A0E9D107 G4NPA1 O84491
gi|385242788|ref|YP_005810627.1| gi|478456340|ref|YP_007726723.1| gi|385270186|ref|YP_005813346.1| gi|471328659|ref|YP_007540184.1| gi|478459046|ref|YP_007732230.1| gi|389858179|ref|YP_006360421.1| gi|385244571|ref|YP_005812415.1| gi|478457233|ref|YP_007725826.1| gi|478473457|ref|YP_007734905.1| gi|527328797|ref|YP_008354987.1| gi|385240010|ref|YP_005807852.1| gi|527321112|ref|YP_008347311.1| gi|478474360|ref|YP_007730436.1| 272561.CT484 672161.CTB_4861 gi|527320194|ref|YP_008346394.1| gi|568111744|ref|YP_008921351.1| gi|389859931|ref|YP_006362171.1| gi|385243691|ref|YP_005811537.1| gi|15605212|ref|NP_219998.1| gi|527322060|ref|YP_008348258.1| gi|385270186|ref|YP_005813346.1| gi|478461747|ref|YP_007736697.1| gi|386262840|ref|YP_005816119.1| gi|527323004|ref|YP_008349201.1| gi|237804834|ref|YP_002888988.1| gi|389859055|ref|YP_006361296.1| gi|478459946|ref|YP_007734014.1| gi|385246397|ref|YP_005815219.1| gi|478428620|ref|YP_007541060.1| gi|385245471|ref|YP_005814294.1| gi|478472555|ref|YP_007733122.1| gi|478449118|ref|YP_007724041.1| NP_219998.1.57406 WP_009871846.1.100466 WP_009871846.1.100644 WP_009871846.1.101362 WP_009871846.1.102133 WP_009871846.1.11717 WP_009871846.1.13674 WP_009871846.1.13837 WP_009871846.1.1409 WP_009871846.1.14786 WP_009871846.1.14984 WP_009871846.1.15381 WP_009871846.1.17422 WP_009871846.1.1923 WP_009871846.1.19304 WP_009871846.1.20022 WP_009871846.1.20093 WP_009871846.1.25246 WP_009871846.1.28239 WP_009871846.1.29171 WP_009871846.1.30792 WP_009871846.1.31128 WP_009871846.1.31373 WP_009871846.1.32156 WP_009871846.1.32801 WP_009871846.1.32856 WP_009871846.1.34934 WP_009871846.1.35043 WP_009871846.1.36244 WP_009871846.1.36518 WP_009871846.1.3661 WP_009871846.1.37417 WP_009871846.1.37673 WP_009871846.1.37956 WP_009871846.1.38504 WP_009871846.1.38813 WP_009871846.1.39258 WP_009871846.1.40272 WP_009871846.1.4187 WP_009871846.1.4264 WP_009871846.1.42889 WP_009871846.1.44223 WP_009871846.1.48551 WP_009871846.1.4939 WP_009871846.1.51530 WP_009871846.1.52091 WP_009871846.1.55117 WP_009871846.1.57520 WP_009871846.1.57533 WP_009871846.1.60937 WP_009871846.1.61004 WP_009871846.1.6151 WP_009871846.1.62239 WP_009871846.1.62510 WP_009871846.1.65182 WP_009871846.1.66489 WP_009871846.1.67104 WP_009871846.1.67250 WP_009871846.1.69355 WP_009871846.1.69519 WP_009871846.1.69991 WP_009871846.1.71619 WP_009871846.1.71686 WP_009871846.1.72034 WP_009871846.1.74323 WP_009871846.1.74635 WP_009871846.1.75470 WP_009871846.1.77153 WP_009871846.1.77651 WP_009871846.1.78375 WP_009871846.1.85256 WP_009871846.1.86066 WP_009871846.1.87079 WP_009871846.1.87298 WP_009871846.1.87666 WP_009871846.1.88177 WP_009871846.1.88937 WP_009871846.1.9107 WP_009871846.1.93216 WP_009871846.1.9343 WP_009871846.1.93600 WP_009871846.1.95142 WP_009871846.1.96955 WP_009871846.1.97602 gi|385240935|ref|YP_005808776.1| gi|385241865|ref|YP_005809705.1| gi|527325098|ref|YP_008351292.1| gi|478458143|ref|YP_007731328.1| gi|478455425|ref|YP_007727615.1| gi|527319237|ref|YP_008345438.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]