SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385270427|ref|YP_005813587.1| from Chlamydia trachomatis A2497

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385270427|ref|YP_005813587.1|
Domain Number 1 Region: 170-402
Classification Level Classification E-value
Superfamily TPR-like 8.91e-16
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 
Weak hits

Sequence:  gi|385270427|ref|YP_005813587.1|
Domain Number - Region: 72-148
Classification Level Classification E-value
Superfamily TPR-like 0.00259
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385270427|ref|YP_005813587.1|
Sequence length 444
Comment hypothetical protein [Chlamydia trachomatis A2497]
Sequence
MCIMWLIVASTLLVCLAMALVFKAYRHVISFRSYVNQVIRDVRLSVDLKEWAVAEMRLAP
ILKKRQYRRKYLFEYIRILRELERFEEAEKLLGEAKKLKLAGAYFFLEVAHKAFRHGAYK
EAAHAFSLLSAELMGEREVARYTISLVYLGEVDAACRIIEPWIGPLAHQEVFISVGHIYF
ATKRYADAIDFYRRARSLGSCPIDVLYNLAHSLRICGQYVDAGMLFRELLGDPVYKDEAM
FNIGLCEQKLGNSKKALLIYQNSELWVRGDALMMRYAALAAADQQDYQLAEHCWTLAFRC
QSYADDWNCCVHYGLALCHLKKYAEAEKVYLRVIQKTPDCLVACKALAWLAGVGHATMIS
AREGIAYAKRALQIKRSPEVLELLSACEAREGNFDVAYDIQAILAERDTTAKERERRSQI
LKNLRQKLPIDQQHIVEVSLLLAA
Download sequence
Identical sequences G4NNP3
gi|385270427|ref|YP_005813587.1| gi|385270427|ref|YP_005813587.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]