SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000000051 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000000051
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000000051   Gene: ENSTTRG00000000056   Transcript: ENSTTRT00000000056
Sequence length 937
Comment pep:novel genescaffold:turTru1:GeneScaffold_815:36465:149962:1 gene:ENSTTRG00000000056 transcript:ENSTTRT00000000056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAMATRTHSGKEDASTVILEQDMCNIAVE
EEYITDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPQGTMEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANFPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSLNKEKRQQNGERTITSDSKSTRPLEKSTEHTEK
KPSDSSVSDKLKKLEFSAEAIKRSAAVAKVSKELSDTQAAFESIAKENSLLGEEDDFVDL
EELSSQNDSGMDKRDSSKECLSLDPAELRKTKSQIISSTMEMQVQSALNFSETECDAELK
GTLDLETCEKQDIMPEVDKQSGSPESQVENTLNIHEDLDKVKLIEYYLNKNKEGSQLPDN
LQKAELSDGKSIEPVGIDITLSSSLPQAGDPPIEGNEQADKTWVKERAPLPLQLGSSTEE
NMNKVDPDSSLEPTLDNSCQGAQMDNKSEIQLWLLKRIQVPIEXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDHLNSFFVLWSPDVYGKDA
KEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEAALPILQPH
SALLENMHIEQLARRLPARVQGYPWSLVYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMD
NQIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGR
GLLDADLYHRSNSSTFNNDLSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences ENSTTRP00000000051 ENSTTRP00000000051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]