SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006098 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006098
Domain Number 1 Region: 246-418
Classification Level Classification E-value
Superfamily ALDH-like 8.51e-42
Family ALDH-like 0.00023
Further Details:      
 
Domain Number 2 Region: 26-119
Classification Level Classification E-value
Superfamily ALDH-like 3.4e-19
Family ALDH-like 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000006098
Domain Number - Region: 470-519
Classification Level Classification E-value
Superfamily ALDH-like 0.000393
Family ALDH-like 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006098   Gene: ENSTTRG00000006442   Transcript: ENSTTRT00000006442
Sequence length 537
Comment pep:novel genescaffold:turTru1:GeneScaffold_1587:186057:205120:-1 gene:ENSTTRG00000006442 transcript:ENSTTRT00000006442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVAAVAAAAAMRARILQVSSKVNSSWHPASSFSSSSVPSVKLFIDGKFIESKSDKWMD
IHNPATNEVIGRVPQATKAEMDAAVSSCKRAFPAWADTSILSRQQVLLRYQQLIKENLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVNFICDHPDIKAISFVGSNRAGEYIFERGSRHGKRVQANMGAKNHGVVMPDANK
ENTLNQLVGAAFGAAGQRCMALSTAILVGEAKKWLPELVERAKKLRVNAGDQPGADLGPL
ITPQAKERVCNLIDSGTKEGASILLDGRDIKVKGYENGNFVGPTIISNAKPNMTCYKEXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGVNVPIPVP
LPMFSFTGSRASFRGDTNFYGKQGIQFYTQLKTVTSQWKEEDASLSSPAVVMPTMGR
Download sequence
Identical sequences ENSTTRP00000006098 ENSTTRP00000006098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]