SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006246 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006246
Domain Number 1 Region: 5-235
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 1.05e-44
Family Galactose oxidase, central domain 0.0067
Further Details:      
 
Domain Number 2 Region: 241-340
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-17
Family Kelch motif 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006246   Gene: ENSTTRG00000006601   Transcript: ENSTTRT00000006600
Sequence length 350
Comment pep:novel genescaffold:turTru1:GeneScaffold_3093:280964:286448:-1 gene:ENSTTRG00000006601 transcript:ENSTTRT00000006600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVPNVKDFQWKRLAPLPSRRVYCSLLETGGQVYAIGGCDDNGVPVDCFEVYSPEADQWT
DLRPLPTARAGVAVTALGKRIMVIGGVGTSQLPLKVVEMYNIDEGKWKKRSMLREAAMGI
SVTAKDYRVYAAGGMGLDLRPHNHLQHYDMLKDVWVSLAPMPTPRYAATSFLRGSKIYVL
GGRQSKYAVNAFEVFDIETRSWTKFPNIPCKRAFSSFVTLDDRLYSLGGLRQGRLYQQPK
FLRTMDVFDMEQGGWLKMERSFFLKKRRADFVAGSLSGRVIVAGGLGNQPTVLETAEAFH
PGKNKWEVLPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS
Download sequence
Identical sequences ENSTTRP00000006246 ENSTTRP00000006246

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]