SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006628 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000006628
Domain Number - Region: 48-104
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 0.017
Family Molybdopterin synthase subunit MoaE 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006628   Gene: ENSTTRG00000007009   Transcript: ENSTTRT00000007008
Sequence length 184
Comment pep:novel genescaffold:turTru1:GeneScaffold_1691:172323:172877:1 gene:ENSTTRG00000007009 transcript:ENSTTRT00000007008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFSSKSLALQAEKKLLSKMAGRSVAHLFVDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAVKVAVLHRSGCFSPSELVLATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVERHLTPKSHGRIRHVFDHFSDPGLLTALYGPDYTQHLGKICDGLRKLLD
EGKL
Download sequence
Identical sequences ENSTTRP00000006628 ENSTTRP00000006628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]