SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007284 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007284
Domain Number 1 Region: 142-446
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-93
Family ALDH-like 0.000000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007284   Gene: ENSTTRG00000007699   Transcript: ENSTTRT00000007699
Sequence length 464
Comment pep:novel scaffold:turTru1:scaffold_102679:114578:118734:-1 gene:ENSTTRG00000007699 transcript:ENSTTRT00000007699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPWRRRPRPSRMSPTSTQSPWVWFSSSAPGTTPSASPSSPWWAPLLQVRGPVLGRGAEG
SLFSTAEGRAWGGGRRPVRRGSLGSGSHRRVRLSQEAVGQASWCRPSQAQMSTQPHRPPC
ALVPGRAEGGWPQHGPDSVCSAGNAVVLKPSELSENTASLLATILPQYLDKDLYPVISGG
VPETTEVLKERFDHILYIGSPGVGRIVMMAAAKHLTPVTLGLGGKNPCYVDKDCDLDVAC
RRIAWGKFMNSGQGCVAPDYILCDPSIQNQVVEKLTKSLKEFYGEDAKKSRDYGRIINSL
HFQRVMGLMEGQKVAYGGTGDATSRYIAPTILVDVDPQSPVMQEEVLGPIMPIVCVRGLE
EAIQFISQREKPLALYVFSLNDKVIKKMIAETSSGGVTANDVIVHTTVPSLPYGGVGGSG
MGSYHGKKSFETFSHRRSCLVRPLLNEEALRARYPPSPAKMPRH
Download sequence
Identical sequences ENSTTRP00000007284 ENSTTRP00000007284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]