SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010821 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010821
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 6.41e-30
Family N-terminal domain of MutM-like DNA repair proteins 0.000000398
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 5e-27
Family Middle domain of MutM-like DNA repair proteins 0.00000173
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.71e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010821   Gene: ENSTTRG00000011411   Transcript: ENSTTRT00000011412
Sequence length 390
Comment pep:novel genescaffold:turTru1:GeneScaffold_1601:9906:14450:1 gene:ENSTTRG00000011411 transcript:ENSTTRT00000011412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASHFVNEACRELVFGGCVEKSPVSRNPEVPFESSAYHISALARGKELRLTL
SPLPGAQPPRGPLALVFRFGMTGSFQLVPSDALPPHAHLRFYTAPPGPRLALCFVDIRRF
GHWDLGGKWQPGRGPCVLLEYEQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRA
EILYRLRIPPFEKARTVLEALQQRRPSPELTLSQKIRAKLQNPDLLELCHSVPKEVVQLG
GKGYGPESTEEDFAAFRAWLRCYGTPGMSSLRDRHGRTIWFQGDPGPLAPKGGKSRKKKS
KGAQRGSEDQVENPPSPNKAPSRTRRARRGLPEQTAAQQPEGTSLQRDPEAPCVPEKGKR
RRQPATSGRRRPQKIKADTPSSEPEETSVS
Download sequence
Identical sequences ENSTTRP00000010821 ENSTTRP00000010821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]