SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011399 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011399
Domain Number 1 Region: 43-293
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 8.07e-47
Family Hypothetical protein cg14615-pa 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011399   Gene: ENSTTRG00000012022   Transcript: ENSTTRT00000012020
Sequence length 296
Comment pep:novel scaffold:turTru1:scaffold_96686:57088:66320:1 gene:ENSTTRG00000012022 transcript:ENSTTRT00000012020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMFPLQGAQMLQMLEKSLRKSLPTSLKVYGTVFHMNQGNPFKLKALVDRWPDFNTVVIRP
QEQDMTDDLDHYTNTYHIYSKDLKNCQEFLSLPEVINWKQHLQIQSSQSSLNEVIQSLAA
TKSFKVKQSQNILYVAIEAIRELAPSLLDVKNLSLSHGKPKAIDQEMFKLSSLDPTHAAV
VNKFWHFGGNEWSQRFIERCIRTFPTFCLLGPEGTPVSWSLMDQTGEMRMGGTLPEYRGH
GLVTYVIYYQTQALIKRGFPVYSHVDKNNKIMQKMSRSLNHIPVPCDWNQWNCVPL
Download sequence
Identical sequences ENSTTRP00000011399 ENSTTRP00000011399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]