SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012548 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012548
Domain Number 1 Region: 156-252
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.32e-23
Family Middle domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 2 Region: 64-113
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 0.000000249
Family N-terminal domain of MutM-like DNA repair proteins 0.014
Further Details:      
 
Domain Number 3 Region: 319-346
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000377
Family Ran binding protein zinc finger-like 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012548   Gene: ENSTTRG00000013224   Transcript: ENSTTRT00000013226
Sequence length 606
Comment pep:novel genescaffold:turTru1:GeneScaffold_762:338043:378235:1 gene:ENSTTRG00000013224 transcript:ENSTTRT00000013226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEGPGCTLNGEKIRARVRPGQAVTDMRGRALQSPGGPGSPPSASGAAGSSQAAALNNNK
DSSQNFLRLFNGHIYSGVETLGKELFMYFGPKALRIHFGMKGFLVINPVKSKNKNGLPPV
FEVQLTKDLICFFDSSVEIRNSAESQQRIRMMEELDVCSPNFSFPRAESEVKKQRGRMLC
DVLMDQKVLPGVGNIIKNEALFDSGLHPAVKVCQLTDEQTHHLVKMIRDFSLLFYRCHKA
GSAVSNHYKVYKRPNCGQCCCKITVCRLGENKRMTYFCPQCQKENAQHVDICRLPARNTT
VSWPSSRGGHLMDSVARKSEEQWTCEVCTLINKPSSEACDACLTSRPTDSVPKNEENPIA
FNSLVKYPCNSFGKPRTEVKINRKTAFGTTTLVLTDFSNKSSALGREESQNQILDGEFPN
PPTNVCFSDTVHSSKERTNYRTQLSNKVNISSMVCSPSKLFSPAYKRLKTTHCSSRDLKS
GNPGFSNRERQSNTPGGPRSLNACSPRCSKHDRPCVLQVVRKDGENKGRHFYACPLPREA
QCGFFEWADLSFPFCNHGKRSIMRTVLKIGPNNGKNFFVCPLGKEKQCSFFQWAENGPGI
NIIPGC
Download sequence
Identical sequences ENSTTRP00000012548 ENSTTRP00000012548 XP_019777178.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]