SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014199 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014199
Domain Number 1 Region: 246-339
Classification Level Classification E-value
Superfamily SEA domain 0.00000000248
Family SEA domain 0.0075
Further Details:      
 
Domain Number 2 Region: 942-1010
Classification Level Classification E-value
Superfamily SEA domain 0.00000144
Family SEA domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014199
Domain Number - Region: 1059-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0241
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014199   Gene: ENSTTRG00000014970   Transcript: ENSTTRT00000014977
Sequence length 1242
Comment pep:novel genescaffold:turTru1:GeneScaffold_348:30460:101663:-1 gene:ENSTTRG00000014970 transcript:ENSTTRT00000014977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPHFGKISLGILIFVLIEGNLPSLTAQTYLSLEESQEPKSTVSFLLTDSESTDSSLS
IEKKQPMDHRETERQWLLRRKRSTLFPNGVKTCPDENVTEAMANHVKYFKVRVCQEAVWE
AFRTFWDRLPGREEYHYWMNLCEDGITTIFEMGTHFSQSVEHRSLIMKKLTYTKETVSSP
ELSSPVPVGDTSTLGGASLSVPYPGVTFYEGISESSLERPEESISNEIENVIEESTKPAV
EQVAEFSIHLLGEQYNEELQDPYSFHHQRLVEEFISEVENAFTGLLGYKDIHVLDFRSPK
ENGSGIDVHYAVTFNGDAISNTTWDLISLHSNKVENHGLVELDDKPTAVYTISNFRDYIA
ETLHQNVLLGTSSLNLDPDSLQLIDVRGVLLPQSEDQVWNTQSSSLQETLPSILDNTPQA
EWPSADEFTMSSISPLDFSSGPPSTTGRELWSESPLGDLVSAPKLAFPSKMSLSSSPEVL
EVSSLTLHSVTPAVLQTGLPVASEERTSGSHSLEDGLTKVKGSEDFLSIDPLPSSPFSRP
MPKEIIPSMEDSGVSLTSSPYPVSSTPFGMDSLASKVKGQLEASTWMPDTSMEKEFIFES
GLGSGSGQKVGLITWPWSKTSLEKSTEPFSKSWLEVEDSEDLLLPTEDTDEKLVIDDRID
SIDQSTEHSKYGHFDRSTNFAEDETLGGPTASIFAETTTQSASPVLSKHTSEVPDIDYYS
ITKSPPLLTSAAISASTDKPIQEPFLKEDMEQTTESSNREWFDSKISVVXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKALEQFLELLVPYLQSNLTGFQNLEILNFRNGS
IVVNSRMKFAKSVPPNVTNTVYVILEDFCTTAYQTMNLAIDKYSLDVESGDQANPCKFQA
CNEFSECLVNPWSGEAECRCYPGYLSVEELPCQSLCDLQPDFCLNDGKCDIMPGHGAICR
CRVGENWWYRGEHCEEFVSEPLVIGITIASMVGILISSAFVFFLIRTLQARYVRRERERP
FSGSSRQPDSLSSVERAVKHNPVFESHGADLEQYEGPYPQRPFYSSTGREMIAGLSREEI
RQMYENSELSREEIQERMRILELYARDPEFAAFVREHQMEEL
Download sequence
Identical sequences ENSTTRP00000014199 ENSTTRP00000014199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]