SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015136 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015136
Domain Number 1 Region: 565-682
Classification Level Classification E-value
Superfamily SEA domain 1.14e-18
Family SEA domain 0.0059
Further Details:      
 
Domain Number 2 Region: 236-326
Classification Level Classification E-value
Superfamily SEA domain 0.0000000144
Family SEA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015136   Gene: ENSTTRG00000015972   Transcript: ENSTTRT00000015972
Sequence length 786
Comment pep:novel genescaffold:turTru1:GeneScaffold_840:309346:397343:-1 gene:ENSTTRG00000015972 transcript:ENSTTRT00000015972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYLETRRAVFVLWIFLQVQGIKDLSIKIYSSEIKDIDNAARIETTENTGKFYKVSTMRRI
FDLAKPRTKRSSFFPTGLKVCPQESMKEILASLQAYYRLRVCQEAVWEAYRIFLDRVPDP
GEYQDWVSICQEETFCLFDIGRNFSNSQEHLDLLQQRIKERNFLERKDEIHTTETLGEPG
ETPEFSTDIASVSPGSLPLPPDDTLLNEIVNNTLPDTKMPTIEREVEFTVLREQKVELSI
SLAKQKFKEELTDSQSPYYQEVAAKSQLQMQKVFKKLPGFKEIHVSGFRPKKERDGSSST
EMQLTAIFQRDKAEAKSPAGDLLSFDSNKIESEGNLHGTMEEDKQMEIYPTASDLRKLIS
KALEEDQSLDMGSIQFTDEIVGSLPGLDPDTQSVLPTLLADITKVATLSPDLPLGQPMLE
TVDRAGQSLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLSISSQDTVGDLDGTDLASTHASSEVLGFSGYV
STLDHFLENITPGPALQYITTSAMTIAARGRELVVFFSLRVANVPFSTDLFNKSSLEYQA
LEQRFTQLLVPYLRSNLTGFKQLEILNFRNGSVIVNSKMKFANSVPYNLTKAVRGVLEDF
RSAAAQQLDLEIDSYSLDVEPADQADPCKFLACGEFAQCVRNEWTEEAECRCRAGYPGPC
ASGEDCDDTPGKGAPCRSPDQSRNQVYETGVKKFQNQQNNKVTRKRNSELLTIGYEEFNH
QDWEGN
Download sequence
Identical sequences ENSTTRP00000015136 ENSTTRP00000015136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]