SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015546 from Tursiops truncatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015546
Domain Number 1 Region: 614-867
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-54
Family YWTD domain 0.00000699
Further Details:      
 
Domain Number 2 Region: 2-262
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-54
Family YWTD domain 0.0000017
Further Details:      
 
Domain Number 3 Region: 313-543
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-51
Family YWTD domain 0.0000027
Further Details:      
 
Domain Number 4 Region: 914-1173
Classification Level Classification E-value
Superfamily YWTD domain 1.01e-38
Family YWTD domain 0.0000735
Further Details:      
 
Domain Number 5 Region: 1302-1342
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000038
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 6 Region: 1264-1299
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 7 Region: 1224-1262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000563
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 8 Region: 870-921
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000207
Family EGF-type module 0.032
Further Details:      
 
Domain Number 9 Region: 569-615
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000034
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 10 Region: 267-310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000484
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1181-1233
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000227
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015546   Gene: ENSTTRG00000016402   Transcript: ENSTTRT00000016402
Sequence length 1582
Comment pep:novel genescaffold:turTru1:GeneScaffold_2232:30756:112876:1 gene:ENSTTRG00000016402 transcript:ENSTTRT00000016402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLLLFANRRDVRLVDAGGVKLESTIVVSGLEDAAAVDFQFSKGAVYWTDVSEEAIKQTY
LNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSETNRIEVANLNGTSRKVLFWQDLD
QPRAIALDPAHGYMYWTDWGEIPRIERAGMDGSTRKVIVDSDIYWPNGLTIDLEEQKLYW
ADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDTLYWTDWQTRSIHACNKRTGDKR
KEILSALYSPMDIQVLSPERQPYYHTQCEENNGGCSHLCLLSPREPFYACACPTGVQLQD
DGQTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQVDDIRHAIAIDYDPLEGYVYWTD
DEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSRK
ILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANLDGQERRVLVNTSLGWPNGLALD
LQEGKLYWGDAKTDKIEVINIDGTKRRTLLEDKLPHIFGFTLLGDFIYWTDWQRRSIERV
HKVKASRDVIIDQLPDLMGLKAVNVAKAVGTNPCADRNGGCSHLCFFTPRAAKCGCPIGL
ELLSDMKTCIVPEAFLVFTSRAAIHRISLDTNNNDVAIPLTGVKESADFDVSNHHIYWTD
VSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGQFRQ
VLVWRDLDNPRSLALDPTKGYIYWTEWGGKPRIVRAFMDGTNCVTLVDKVGRANDLTIDY
ADQRLYWTDLDTNMIESSNMLGQERVVIADDLPHPFGLTQYSDYIYWTDWNLHSIERADK
TSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCVHNNGQCGQLCLAVPSGRRCSCASHYT
LDPSSRNCSPPTTFLLFSQKCAISRMIPDDHHSPNLILPLHGLRNVKAIDYDPLDKFIYW
VDGRQNIKRAKDDGTQPFVLTSPSQSQNPDRQPHDLSVDVYSRTLFWTCEATDTINVHRL
NGEAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDRAAKIERAALDGTEREVLFTTGLIR
PVALVVDNTLGKLFWVDADLKRIESCDLSGANRLTLEDANIVQPVGLTVLGRHLYWIDRQ
QQMIERVDKTTGDARTRVQGRVAHLTGIHAVEDISLEEFSAHPCARDNGGCSHICIAKGD
GTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATGEIDCIPGAWRCDGFPECDDQSDEE
GCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDEADCDAVCLPNQFRCASGQCVLIKQ
QCDSFPDCVDGSDELMCEITKLPSDDGPAHSSAIGPVIGIILSLFIMGGVYFVCQRVVCQ
RYAGANGPFPHEYVSGTPHVPLNFIAPGGSQHGPFTGISCSKSMMSSVSLMGGRAGVPLY
DRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPSLYNVDVFYPSSIPATARPYRPYII
RGMAPPTTPCSTDVCDSDYSASRWKASKYYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPS
PATERSYFHLFPPPPSPCTDSS
Download sequence
Identical sequences ENSTTRP00000015546 ENSTTRP00000015546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]