SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442555651|ref|YP_007365476.1| from Lawsonia intracellularis N343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442555651|ref|YP_007365476.1|
Domain Number 1 Region: 269-420
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 2.88e-47
Family Peptidoglycan hydrolase LytM 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|442555651|ref|YP_007365476.1|
Sequence length 437
Comment peptidase M23 [Lawsonia intracellularis N343]
Sequence
MSKTKLLVITIGIASIILAAATYIFFKNTDPPIISMIQPTQYISPRQPLTLTITSKYSPL
KLIQIIVKQNEYTKTLINQPIINGHLIETVDIDFKKSGLQDGPFELIVKAQDSSYSNFGK
GNISNKTWDMNFDSQPPQITIHSPTPSLHKGSATAIAFTVSKPVAVIGVQLEEKFFPAFQ
QANGTYYCFFPFPIEFSPKTFNPKLFAQDLAGNKSYISVHVHSLERSFKIDTLTITDTFL
DKKMPNFEQNFPDTQTQVERYIKVNSILRIENEKKLIEISKKTSPMMLWSGKFHTLPRAA
VKATFGENRTYMYQNQKIDQQFHMGLDLASTANAPIPAANDGIVVYTGDLGIYGNIVIID
HGLGLQTLYSHLSKITAKEGDVVKKGDLIGYTGMTGLAGGDHLHFGFLVGGIQVNPIDWL
DPKWIKNTIITRLNNNV
Download sequence
Identical sequences Q1MRE4
gi|442555651|ref|YP_007365476.1| gi|94986820|ref|YP_594753.1| 363253.LI0376 WP_011526461.1.40060 WP_011526461.1.98040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]