SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|442555883|ref|YP_007365708.1| from Lawsonia intracellularis N343

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|442555883|ref|YP_007365708.1|
Domain Number 1 Region: 315-440
Classification Level Classification E-value
Superfamily TPR-like 1.86e-20
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|442555883|ref|YP_007365708.1|
Sequence length 498
Comment peptidase M48 family protein [Lawsonia intracellularis N343]
Sequence
MKCHILIDWLRTVLTLLHNIFYKKLLPFSYIKVVIFSCCTIVLFSTSLILTPIYASGLFS
SMGLKEELELGKKFNLLVRSQMAVVEDPEIVGYIQSIVDQLAASMPPQPFQFKASVVLNN
SVNAFAIPGGYVFVNTGLIMNMENESELVGALAHELAHVTQRHIARRMERAQIVNVASIL
GALASVFLGGGNTTGAVFAGSLAAGQTAMLNYSRSDETEADQIGLQYLVKAGFKPQGMEE
AFEKIRRKQWASGASTPEYLSTHPDIGERINEIHSRVASLPQSIQARVENNKRFKRVRTL
IWARYGEPETAYWLFTKSGEKDCLALMGLGILAERKNKIKVAEDAFHKAVVCAPNDALIL
RETGMFYYNRGDGTQSIQFLKKALSLDSKDVLAQFFYARALDDAGNSTEAQTYYKQLLKI
LPEDAEVHYIYGRSLGQSGNVFEAYIHLAYSALYQNDIKKFTLWSEKARSLAKTSEQENQ
LKSLMKIHEERVEITTQE
Download sequence
Identical sequences A0A1S8BWV0 Q1MQR6
363253.LI0607 gi|442555883|ref|YP_007365708.1| gi|94987049|ref|YP_594982.1| WP_011526690.1.40060 WP_011526690.1.91582 WP_011526690.1.98040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]